PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_29133_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 285aa    MW: 31005 Da    PI: 10.4329
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_29133_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.82.3e-30131186258
                   CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                  p+YVNaKQy++I++RRq+Rak+  ++kl +k+rkpy+h SRh hA+rRpRg+gGrF
  Cotton_A_29133_BGI-A2_v1.0 131 GPIYVNAKQYKGIMRRRQSRAKAVLQNKL-TKARKPYMHYSRHLHAMRRPRGCGGRF 186
                                 69***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-34128189IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.454129189IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.6E-26132186IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-21132154IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.6E-21163186IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MQTLHLKEHG GIGNQPMGQL ASTPPSSLPT LPWCSVLGSH QSLHGGEAFG AQLKPFLMEH  60
PSNGDQVFSS KQLNKGNTAQ FTIFPGDEQN KPQAVTSLQS DPSENRARFE LGFGQHMGRV  120
MLPLNMASEE GPIYVNAKQY KGIMRRRQSR AKAVLQNKLT KARKPYMHYS RHLHAMRRPR  180
GCGGRFLNTR GSGSDKDVTA TRKATQGLIS NRSCSSDSGT LNSSKGPTHS GASEVTSIYS  240
RGDLDHHFLI DHLGLSVHSI SSMINNQRGG TVTVATADNC CNLKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A1e-16130187260HAPB protein
4g92_A1e-16130187260HAPB protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5836292e-34JX583629.1 Gossypium hirsutum clone NBRI_GE16721 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012435019.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLA0A0D2TSD80.0A0A0D2TSD8_G
STRINGGLYMA03G36140.42e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.19e-36nuclear factor Y, subunit A2